angiotensin converting enzyme

Angiotensin-converting enzyme (Kininase II) is a zinc-dependent peptidase and extracellular enzyme that acts as a counterbalance to ACE in the renin-angiotensin system.Angiotensin-converting enzyme is a potent vasoconstrictor used in the study of cardiovascular and immune diseases. Angiotensin-converting enzyme is a potent vasoconstrictor used to study cardiovascular and immune diseases.

L-Isoleucyl-L-arginine, a dipeptide composed of L-isoleucine and L-arginine, acts as a potent angiotensin-converting enzyme (ACE) inhibitor and is utilized in hypertension research [1].

Ovalbumin (154-159), a peptide fragment derived from ovalbumin, acts as a potent inhibitor of the angiotensin-converting enzyme (ACE) and is utilized in hypertension research [1] [2].

Ovotransferrin (328-332), with an IC50 of 20 μM, exhibits protective activity against hypertension by inhibiting the Angiotensin-Converting Enzyme (ACE) and also displays anti-Cholinesterase (ChE) activity, suggesting a potential role in the treatment of Alzheimer's disease [1] [2].

Tuna AI acetate is an inhibitor of angiotensin-converting enzyme (ACE) in non-competitive manner derived from tuna muscle.

H-Val-Pro-Pro-OH is an inhibitor of Angiotensin I converting enzyme (ACE)( IC50 : 9 μM).

Hemorphin-7 acetate is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).

Acetyl Ser-Asp-Lys-Pro is formed in bone marrow cells by enzymatic processing of thymosin β4. It inhibits the entry of pluripotent hemopoietic stem cells into S-phase of the cell cycle and protects against Ara-C lethality in mice.

Acein acetate is a high-affinity angiotensin-converting enzyme (ACE) ligand (Kd = 2.79 nM). Concentrations up to 500 nM had no significant effect on ACE enzyme activity. Enhanced NMDA + D-serine-induced dopamine release from striatal slices in vitro and striatum in vivo.

DX600 is a useful organic compound for research related to life sciences. The catalog number is T35324 and the CAS number is 478188-26-0.

N-Hippuryl-His-Leu hydrate (N-Benzoyl-Gly-His-Leu hydrate) is a peptide compound that is an angiotensin-converting enzyme (ACE) substrate and can be used as a model peptide for measuring ACE-I inhibitory activity.

Angiotensin I II (1-6) TFA is a chemical compound comprising amino acids 1-6, derived from the Angiotensin I II peptide. This peptide is formed by the cleavage of angiotensinogen by renin, with Angiotensin I subsequently hydrolyzed by angiotensin-converting enzyme (ACE) to produce biologically active Angiotensin II. Angiotensin II has been extensively studied for its potential applications in the treatment of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy[1][2][3].

Angiotensin (1-7) acetate (Ang-(1-7) acetate) is an amino acid sequence present in angiotensin, which has antifibrotic and cardioprotective effects and inhibits the activity of purified canine angiotensin converting enzyme (ACE). Angiotensin (1-7) acetate inhibits the growth of tumor cells and reduces local inflammation and angiogenesis in several types of cancer, blocks angiotensin II-induced smooth muscle cell proliferation and hypertrophy, and can be used to study atherosclerosis and novel coronavirus infection.

H-Tyr-Phe-OH(L-Tyrosyl-L-phenylalanine) is a dipeptide polypeptide composed of tyrosine and phenylalanine that inhibits the activity of the angiotensin-converting enzyme (ACE) and has oral activity. It can be used as a biomarker for the study of thyroid nodules and also exhibits xanthine oxidase inhibitory (uric acid lowering) activity and acts as a regulator of IL-8 production by neutrophil-like cells.

Angiotensin (1-7) (ASP-ARG-VAL-TYR-ILE-HIS-PRO) is a synthetic heptapeptide identical to endogenous angiotensin-(1-7) , inhibits purified canine ACE activity (IC50=0.65 μM) with vasodilator and antiproliferative activities.

H-Ile-Pro-Pro-OH hydrochloride, a tripeptide derived from milk [1], functions as an ACE inhibitor [1] with an IC 50 of 5 μM [2], and is recognized for its antihypertensive properties [1].

N-Acetyl-Ser-Asp-Lys-Pro (Ac-SDKP) acetate, a specific substrate for the N-terminal active site of angiotensin-converting enzyme (ACE), functions as a natural inhibitor of pluripotent hematopoietic stem cell proliferation and exhibits anti-inflammatory and antifibrotic properties [1] [2].

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2's function [1].

Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine, is a 4-amino acid peptide known for its blood pressure-lowering effects and its role as an angiotensin-converting enzyme (ACE) inhibitor. This compound is frequently used in high blood pressure research.

Bradykinin Potentiator C, a potent inhibitor of angiotensin-converting enzyme (ACE) with an inhibitory concentration (IC 50) of 7.1 μM for rabbit lung ACE, is regarded as a prototype for functional peptides [1].

Abz-Ser-Pro-3-nitro-Tyr is a substrate of ACE2 (angiotensin-converting enzyme-2) [1].

Hippuryl-His-Leu-OH serves as a substrate to measure angiotensin I converting enzyme activity. Upon its cleavage, the resultant His-Leu moiety reacts with o-phthaldialdehyde or Fluorescamine, facilitating fluorescence detection [1] [2] [3].

H-Phe-Arg-OH is a dipeptide comprising phenylalanine and arginine, which can be separated from Bradykinin using Angiotensin-converting enzyme (ACE), and is utilized for metabolic research [1].

H-Pro-Phe-OH, a dipeptide composed of proline and phenylalanine, functions both as a substrate for prolinase and in polypeptide synthesis. Phenylalanine, an aromatic amino acid within this compound, has the capability to inhibit the activity of Angiotensin-converting enzyme (ACE) [1] [2].